Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 2BQZ
Model -
Chain B
Position 20
SCOP Class None
MODRES N-METHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
                 *** *****                         *                                                   
-----------------RHRXVLRDN-------------------------Y---------------------------------------------------
                 ___H_____                         _                                                   
                 CCCEECCCC                         C                                                   
                 ZZdddedfZ                         Z                                                   

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
RHRXVLRDNY
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 2BQZ MLZ B 20 LYS N-METHYL-LYSINE
LINK C ARG B 19 N MLZ B 20 1555 1555 1.34
LINK C MLZ B 20 N VAL B 21 1555 1555 1.44
SITE 4 AC1 16 HOH A2318 HIS B 18 MLZ B 20 HOH E2136
HETATM 1324 N MLZ B 20 3.617 -6.042 0.333 1.00 4.42 N
ANISOU 1324 N MLZ B 20 507 619 551 25 -16 55 N
HETATM 1325 CA MLZ B 20 3.308 -5.258 1.507 1.00 5.12 C
ANISOU 1325 CA MLZ B 20 576 658 711 -57 -4 17 C
HETATM 1326 CB MLZ B 20 2.292 -4.156 1.219 1.00 5.99 C
ANISOU 1326 CB MLZ B 20 711 741 824 -1 -11 29 C
HETATM 1327 CG MLZ B 20 2.729 -3.154 0.173 1.00 7.09 C
ANISOU 1327 CG MLZ B 20 864 858 969 -70 -11 45 C
HETATM 1328 CD MLZ B 20 1.584 -2.231 -0.283 1.00 9.21 C
ANISOU 1328 CD MLZ B 20 1049 1118 1330 -12 47 74 C
HETATM 1329 CE MLZ B 20 2.085 -1.650 -1.594 1.00 11.14 C
ANISOU 1329 CE MLZ B 20 1276 1357 1599 -85 35 180 C
HETATM 1330 NZ MLZ B 20 1.180 -1.000 -2.467 1.00 13.04 N
ANISOU 1330 NZ MLZ B 20 1558 1843 1553 -83 15 182 N
HETATM 1331 CM MLZ B 20 1.707 -0.310 -3.618 1.00 9.89 C
ANISOU 1331 CM MLZ B 20 1168 1453 1136 -48 -14 0 C
HETATM 1332 C MLZ B 20 2.734 -6.240 2.490 1.00 5.78 C
ANISOU 1332 C MLZ B 20 759 707 727 -26 -17 24 C
HETATM 1333 O MLZ B 20 2.064 -7.180 2.113 1.00 5.32 O
ANISOU 1333 O MLZ B 20 598 648 776 -40 -55 -22 O