Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 2BQZ
Model -
Chain F
Position 20
SCOP Class None
MODRES N-METHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
                 *** *****                         *                                                   
-----------------RHRXVLRDN-------------------------Y---------------------------------------------------
                 ___H_____                         _                                                   
                 CCCEECCSC                         C                                                   
                 ZZddddeeZ                         Z                                                   

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
RHRXVLRDNY
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 2BQZ MLZ F 20 LYS N-METHYL-LYSINE
LINK C ARG F 19 N MLZ F 20 1555 1555 1.31
LINK C MLZ F 20 N VAL F 21 1555 1555 1.39
SITE 5 AC2 20 HOH E2247 HOH E2248 HIS F 18 MLZ F 20
HETATM 2713 N MLZ F 20 7.775 31.394 25.461 1.00 5.97 N
ANISOU 2713 N MLZ F 20 728 772 769 -23 8 -6 N
HETATM 2714 CA MLZ F 20 8.240 30.027 25.412 1.00 5.67 C
ANISOU 2714 CA MLZ F 20 715 754 683 -12 -2 -50 C
HETATM 2715 CB MLZ F 20 9.159 29.785 24.229 1.00 6.32 C
ANISOU 2715 CB MLZ F 20 763 830 804 31 31 -50 C
HETATM 2716 CG MLZ F 20 8.449 30.058 22.908 1.00 7.42 C
ANISOU 2716 CG MLZ F 20 1009 863 945 -41 -119 -65 C
HETATM 2717 CD MLZ F 20 9.409 30.028 21.714 1.00 9.80 C
ANISOU 2717 CD MLZ F 20 1194 1277 1249 -13 -90 -86 C
HETATM 2718 CE MLZ F 20 8.664 30.604 20.512 1.00 11.08 C
ANISOU 2718 CE MLZ F 20 1391 1579 1240 50 -94 -38 C
HETATM 2719 NZ MLZ F 20 9.438 31.092 19.422 1.00 13.83 N
ANISOU 2719 NZ MLZ F 20 1554 1825 1874 -98 -134 135 N
HETATM 2720 CM MLZ F 20 8.787 31.732 18.306 1.00 12.90 C
ANISOU 2720 CM MLZ F 20 1621 1680 1598 -89 -39 43 C
HETATM 2721 C MLZ F 20 8.981 29.774 26.682 1.00 5.95 C
ANISOU 2721 C MLZ F 20 677 818 763 28 23 -32 C
HETATM 2722 O MLZ F 20 9.604 30.663 27.217 1.00 6.19 O
ANISOU 2722 O MLZ F 20 746 772 833 -22 -27 12 O