Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 17
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 2KWN
Model 1
Chain B
Position 16
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
         ******* *******                                                                               
---------GLGKGGAXRHRKVLR-------------------------------------------------------------------------------
         _______H_______                                                                               
         CCSCCSSCCSSCCCC                                                                               
         ZZgaiafknnpgaZZ                                                                               

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
GLGKGGAXRHRKVLR
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			


This structure was solved By NMR.
The PDB records below correspond to the MODEL 1.



REMARK 500 1 ALY B 16 -45.43 -172.29
REMARK 500 2 ALY B 16 -58.14 -150.04
MODRES 2KWN ALY B 16 LYS N(6)-ACETYLLYSINE
LINK C ALA B 15 N ALY B 16 1555 1555 1.33
LINK C ALY B 16 N ARG B 17 1555 1555 1.33
HETATM 82 OH ALY B 16 -4.695 -4.511 1.142 1.00 0.00 O
HETATM 83 CH ALY B 16 -5.519 -5.326 0.726 1.00 0.00 C
HETATM 84 CH3 ALY B 16 -6.015 -5.171 -0.714 1.00 0.00 C
HETATM 85 NZ ALY B 16 -6.255 -6.046 1.565 1.00 0.00 N
HETATM 86 CE ALY B 16 -6.546 -5.590 2.918 1.00 0.00 C
HETATM 87 CD ALY B 16 -5.832 -6.412 3.981 1.00 0.00 C
HETATM 88 CG ALY B 16 -6.236 -5.974 5.383 1.00 0.00 C
HETATM 89 CB ALY B 16 -5.667 -6.901 6.448 1.00 0.00 C
HETATM 90 CA ALY B 16 -4.717 -6.212 7.437 1.00 0.00 C
HETATM 91 N ALY B 16 -5.407 -5.150 8.165 1.00 0.00 N
HETATM 92 C ALY B 16 -3.499 -5.672 6.695 1.00 0.00 C
HETATM 93 O ALY B 16 -2.423 -6.270 6.743 1.00 0.00 O
HETATM 94 HH31 ALY B 16 -6.489 -6.087 -1.033 1.00 0.00 H
HETATM 95 HH32 ALY B 16 -6.729 -4.360 -0.759 1.00 0.00 H
HETATM 96 HH33 ALY B 16 -5.179 -4.952 -1.362 1.00 0.00 H
HETATM 97 HZ ALY B 16 -6.889 -6.685 1.178 1.00 0.00 H
HETATM 98 HE3 ALY B 16 -6.238 -4.555 3.009 1.00 0.00 H
HETATM 99 HE2 ALY B 16 -7.609 -5.660 3.085 1.00 0.00 H
HETATM 100 HD3 ALY B 16 -6.087 -7.453 3.851 1.00 0.00 H
HETATM 101 HD2 ALY B 16 -4.766 -6.282 3.867 1.00 0.00 H
HETATM 102 HG3 ALY B 16 -5.870 -4.974 5.558 1.00 0.00 H
HETATM 103 HG2 ALY B 16 -7.313 -5.982 5.453 1.00 0.00 H
HETATM 104 HB3 ALY B 16 -6.492 -7.327 7.000 1.00 0.00 H
HETATM 105 HB2 ALY B 16 -5.132 -7.696 5.951 1.00 0.00 H
HETATM 106 HA ALY B 16 -4.383 -6.940 8.161 1.00 0.00 H
HETATM 107 H ALY B 16 -5.125 -4.221 8.034 1.00 0.00 H