Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 2LVM
Model 1
Chain B
Position 20
SCOP Class None
MODRES N-DIMETHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
              ****** *******                                                                           
--------------GAKRHRXVLRDNIQ---------------------------------------------------------------------------
              ______H_______                                                                           
              CCCCCSCCCCSSCC                                                                           
              ZZcfbdcddfklZZ                                                                           

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
GAKRHRXVLRDNIQ
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			


This structure was solved By NMR.
The PDB records below correspond to the MODEL 1.



REMARK 500 4 MLY B 20 18.51 42.57
MODRES 2LVM MLY B 20 LYS N-DIMETHYL-LYSINE
LINK C ARG B 19 N MLY B 20 1555 1555 1.33
LINK C MLY B 20 N VAL B 21 1555 1555 1.33
HETATM 2055 N MLY B 20 -22.758 -19.378 -9.484 1.00 0.00 N
HETATM 2056 CA MLY B 20 -23.214 -18.030 -9.173 1.00 0.00 C
HETATM 2057 CB MLY B 20 -23.491 -17.924 -7.660 1.00 0.00 C
HETATM 2058 CG MLY B 20 -23.626 -16.505 -7.077 1.00 0.00 C
HETATM 2059 CD MLY B 20 -22.273 -15.903 -6.649 1.00 0.00 C
HETATM 2060 CE MLY B 20 -21.990 -14.579 -7.354 1.00 0.00 C
HETATM 2061 NZ MLY B 20 -20.609 -14.072 -7.155 1.00 0.00 N
HETATM 2062 CH1 MLY B 20 -20.248 -13.658 -5.777 1.00 0.00 C
HETATM 2063 CH2 MLY B 20 -19.511 -14.779 -7.867 1.00 0.00 C
HETATM 2064 C MLY B 20 -22.182 -17.052 -9.708 1.00 0.00 C
HETATM 2065 O MLY B 20 -21.008 -17.089 -9.355 1.00 0.00 O
HETATM 2066 H MLY B 20 -22.380 -19.937 -8.731 1.00 0.00 H
HETATM 2067 HA MLY B 20 -24.143 -17.828 -9.714 1.00 0.00 H
HETATM 2068 HB2 MLY B 20 -22.716 -18.452 -7.101 1.00 0.00 H
HETATM 2069 HB3 MLY B 20 -24.425 -18.451 -7.471 1.00 0.00 H
HETATM 2070 HG2 MLY B 20 -24.247 -16.572 -6.182 1.00 0.00 H
HETATM 2071 HG3 MLY B 20 -24.161 -15.861 -7.778 1.00 0.00 H
HETATM 2072 HD2 MLY B 20 -21.462 -16.606 -6.829 1.00 0.00 H
HETATM 2073 HD3 MLY B 20 -22.312 -15.699 -5.583 1.00 0.00 H
HETATM 2074 HE2 MLY B 20 -22.696 -13.849 -6.980 1.00 0.00 H
HETATM 2075 HE3 MLY B 20 -22.197 -14.667 -8.413 1.00 0.00 H
HETATM 2076 HH11 MLY B 20 -19.509 -14.333 -5.350 1.00 0.00 H
HETATM 2077 HH12 MLY B 20 -19.821 -12.660 -5.813 1.00 0.00 H
HETATM 2078 HH13 MLY B 20 -21.117 -13.629 -5.120 1.00 0.00 H
HETATM 2079 HH21 MLY B 20 -18.581 -14.223 -7.745 1.00 0.00 H
HETATM 2080 HH22 MLY B 20 -19.373 -15.787 -7.475 1.00 0.00 H
HETATM 2081 HH23 MLY B 20 -19.711 -14.844 -8.939 1.00 0.00 H
HETATM 2082 HZ MLY B 20 -20.681 -13.171 -7.680 1.00 0.00 H