Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 6
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 2RS9
Model 1
Chain A
Position 5
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
 **** *****                                                                                            
-SGRGXGGKGL--------------------------------------------------------------------------------------------
 ____H_____                                                                                            
 CCCSSSSCCC                                                                                            
 ZZgjiacdZZ                                                                                            

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
SGRGXGGKGL
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			


This structure was solved By NMR.
The PDB records below correspond to the MODEL 1.



MODRES 2RS9 ALY A 5 LYS N(6)-ACETYLLYSINE
LINK C GLY A 4 N ALY A 5 1555 1555 1.34
LINK C ALY A 5 N GLY A 6 1555 1555 1.34
HETATM 52 OH ALY A 5 12.157 -1.503 8.288 1.00 0.00 O
HETATM 53 CH ALY A 5 11.398 -0.587 7.990 1.00 0.00 C
HETATM 54 CH3 ALY A 5 10.109 -0.913 7.273 1.00 0.00 C
HETATM 55 NZ ALY A 5 11.597 0.713 8.240 1.00 0.00 N
HETATM 56 CE ALY A 5 12.694 1.436 8.917 1.00 0.00 C
HETATM 57 CD ALY A 5 13.751 0.572 9.633 1.00 0.00 C
HETATM 58 CG ALY A 5 14.819 0.028 8.667 1.00 0.00 C
HETATM 59 CB ALY A 5 15.557 -1.190 9.240 1.00 0.00 C
HETATM 60 CA ALY A 5 16.394 -1.896 8.148 1.00 0.00 C
HETATM 61 N ALY A 5 16.270 -3.359 8.327 1.00 0.00 N
HETATM 62 C ALY A 5 17.862 -1.424 8.017 1.00 0.00 C
HETATM 63 O ALY A 5 18.236 -0.336 8.462 1.00 0.00 O
HETATM 64 HH31 ALY A 5 10.070 -0.378 6.327 1.00 0.00 H
HETATM 65 HH32 ALY A 5 10.065 -1.987 7.085 1.00 0.00 H
HETATM 66 HH33 ALY A 5 9.263 -0.625 7.896 1.00 0.00 H
HETATM 67 HZ ALY A 5 10.845 1.305 7.917 1.00 0.00 H
HETATM 68 HE3 ALY A 5 13.195 2.087 8.196 1.00 0.00 H
HETATM 69 HE2 ALY A 5 12.240 2.084 9.669 1.00 0.00 H
HETATM 70 HD3 ALY A 5 14.259 1.191 10.374 1.00 0.00 H
HETATM 71 HD2 ALY A 5 13.256 -0.234 10.174 1.00 0.00 H
HETATM 72 HG3 ALY A 5 14.340 -0.253 7.729 1.00 0.00 H
HETATM 73 HG2 ALY A 5 15.544 0.810 8.452 1.00 0.00 H
HETATM 74 HB3 ALY A 5 16.185 -0.895 10.082 1.00 0.00 H
HETATM 75 HB2 ALY A 5 14.803 -1.886 9.611 1.00 0.00 H
HETATM 76 HA ALY A 5 15.948 -1.628 7.186 1.00 0.00 H
HETATM 77 H ALY A 5 15.604 -3.841 7.739 1.00 0.00 H