Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 3F9X
Model -
Chain E
Position 20
SCOP Class None
MODRES N-DIMETHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
               ***** ****                                                                              
---------------AKRHRXVLRD------------------------------------------------------------------------------
               M____H____                                                                              
                CCCCEEECC                                                                              
                ZZdddddZZ                                                                              

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XKRHRXVLRD
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3F9X MLY E 20 LYS N-DIMETHYL-LYSINE
SHEET 4 G 4 MLY E 20 LEU E 22 1 O MLY E 20 N TYR B 274
LINK C ARG E 19 N MLY E 20 1555 1555 1.33
LINK C MLY E 20 N VAL E 21 1555 1555 1.32
SITE 4 AC2 15 HOH B 398 HIS E 18 MLY E 20
HETATM 5163 N MLY E 20 -2.116 -9.862 14.026 1.00 16.35 N
ANISOU 5163 N MLY E 20 1792 2139 2283 33 111 -67 N
HETATM 5164 CA MLY E 20 -2.368 -9.061 15.213 1.00 14.97 C
ANISOU 5164 CA MLY E 20 1664 1848 2175 -19 -23 -20 C
HETATM 5165 CB MLY E 20 -3.258 -7.858 14.941 1.00 15.25 C
ANISOU 5165 CB MLY E 20 1627 1960 2208 -55 -27 -25 C
HETATM 5166 CG MLY E 20 -2.624 -6.940 13.897 1.00 15.67 C
ANISOU 5166 CG MLY E 20 1735 1862 2358 46 44 130 C
HETATM 5167 CD MLY E 20 -3.639 -5.901 13.450 1.00 15.11 C
ANISOU 5167 CD MLY E 20 1673 1659 2410 -170 82 199 C
HETATM 5168 CE MLY E 20 -3.076 -5.109 12.295 1.00 15.89 C
ANISOU 5168 CE MLY E 20 1768 1823 2445 -61 -121 380 C
HETATM 5169 NZ MLY E 20 -2.587 -5.947 11.194 1.00 17.92 N
ANISOU 5169 NZ MLY E 20 2063 2474 2272 -516 270 398 N
HETATM 5170 CH1 MLY E 20 -3.615 -6.924 10.755 1.00 20.11 C
ANISOU 5170 CH1 MLY E 20 2173 2791 2677 -573 25 241 C
HETATM 5171 CH2 MLY E 20 -2.232 -5.035 10.081 1.00 19.02 C
ANISOU 5171 CH2 MLY E 20 2271 2677 2280 -491 385 416 C
HETATM 5172 C MLY E 20 -3.007 -9.952 16.238 1.00 14.09 C
ANISOU 5172 C MLY E 20 1534 1721 2100 79 -11 73 C
HETATM 5173 O MLY E 20 -3.840 -10.813 15.900 1.00 14.38 O
ANISOU 5173 O MLY E 20 1450 1614 2398 -48 50 -64 O