Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 3F9X
Model -
Chain F
Position 20
SCOP Class None
MODRES N-DIMETHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
               ***** ****                                                                              
---------------AKRHRXVLRD------------------------------------------------------------------------------
               M____H___M                                                                              
                CCCCEECC                                                                               
                ZZcdddZZ                                                                               

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XKRHRXVLRX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3F9X MLY F 20 LYS N-DIMETHYL-LYSINE
SHEET 4 C 4 MLY F 20 VAL F 21 1 O MLY F 20 N TYR A 274
LINK C ARG F 19 N MLY F 20 1555 1555 1.32
LINK C MLY F 20 N VAL F 21 1555 1555 1.32
SITE 5 AC1 18 HIS F 18 MLY F 20
HETATM 5247 N MLY F 20 0.545 3.890 -7.806 1.00 18.79 N
ANISOU 5247 N MLY F 20 2477 2440 2222 -195 174 -43 N
HETATM 5248 CA MLY F 20 1.144 2.569 -7.952 1.00 18.39 C
ANISOU 5248 CA MLY F 20 2402 2376 2211 -247 91 -68 C
HETATM 5249 CB MLY F 20 2.037 2.480 -9.178 1.00 19.30 C
ANISOU 5249 CB MLY F 20 2422 2594 2316 -237 92 -34 C
HETATM 5250 CG MLY F 20 1.238 2.817 -10.424 1.00 20.53 C
ANISOU 5250 CG MLY F 20 2510 2777 2515 -278 208 51 C
HETATM 5251 CD MLY F 20 2.168 2.997 -11.630 1.00 22.66 C
ANISOU 5251 CD MLY F 20 2795 3040 2773 -315 318 64 C
HETATM 5252 CE MLY F 20 1.398 3.583 -12.809 1.00 24.52 C
ANISOU 5252 CE MLY F 20 3418 3231 2668 -90 431 -39 C
HETATM 5253 NZ MLY F 20 2.215 3.729 -14.042 1.00 26.32 N
ANISOU 5253 NZ MLY F 20 3770 3225 3004 109 759 -96 N
HETATM 5254 CH1 MLY F 20 2.469 2.462 -14.736 1.00 24.47 C
ANISOU 5254 CH1 MLY F 20 3705 2979 2612 -13 696 -113 C
HETATM 5255 CH2 MLY F 20 1.450 4.575 -14.950 1.00 28.13 C
ANISOU 5255 CH2 MLY F 20 4199 3601 2890 13 653 -60 C
HETATM 5256 C MLY F 20 1.894 2.331 -6.666 1.00 18.75 C
ANISOU 5256 C MLY F 20 2557 2415 2153 -196 60 -138 C
HETATM 5257 O MLY F 20 2.501 3.263 -6.132 1.00 18.61 O
ANISOU 5257 O MLY F 20 2383 2487 2202 -495 24 -328 O