Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 3F9X
Model -
Chain G
Position 20
SCOP Class None
MODRES N-DIMETHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
               ***** ****                                                                              
---------------AKRHRXVLRD------------------------------------------------------------------------------
               M____H____                                                                              
                CCCCEECCC                                                                              
                ZZddddeZZ                                                                              

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XKRHRXVLRD
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3F9X MLY G 20 LYS N-DIMETHYL-LYSINE
SHEET 4 K 4 MLY G 20 VAL G 21 1 O MLY G 20 N TYR C 274
LINK C ARG G 19 N MLY G 20 1555 1555 1.33
LINK C MLY G 20 N VAL G 21 1555 1555 1.34
HETATM 5322 N MLY G 20 -3.153 12.228 -32.196 1.00 27.14 N
ANISOU 5322 N MLY G 20 3402 3329 3581 271 35 -155 N
HETATM 5323 CA MLY G 20 -3.479 12.830 -30.901 1.00 25.37 C
ANISOU 5323 CA MLY G 20 3174 3139 3328 232 -73 -178 C
HETATM 5324 CB MLY G 20 -4.250 14.130 -31.088 1.00 25.37 C
ANISOU 5324 CB MLY G 20 3122 3137 3382 216 -93 -120 C
HETATM 5325 CG MLY G 20 -3.584 15.109 -32.062 1.00 25.30 C
ANISOU 5325 CG MLY G 20 3175 2979 3460 294 -34 14 C
HETATM 5326 CD MLY G 20 -4.611 16.105 -32.623 1.00 25.85 C
ANISOU 5326 CD MLY G 20 3240 2959 3622 210 119 37 C
HETATM 5327 CE MLY G 20 -4.130 16.929 -33.824 1.00 27.42 C
ANISOU 5327 CE MLY G 20 3426 3397 3596 134 -23 -125 C
HETATM 5328 NZ MLY G 20 -3.795 16.103 -34.996 1.00 26.51 N
ANISOU 5328 NZ MLY G 20 3142 3157 3772 -138 -196 -444 N
HETATM 5329 CH1 MLY G 20 -4.896 15.181 -35.383 1.00 25.40 C
ANISOU 5329 CH1 MLY G 20 2900 3218 3532 -482 -631 -652 C
HETATM 5330 CH2 MLY G 20 -3.518 16.965 -36.154 1.00 27.13 C
ANISOU 5330 CH2 MLY G 20 3369 3142 3798 -7 73 -379 C
HETATM 5331 C MLY G 20 -4.239 11.820 -30.097 1.00 23.38 C
ANISOU 5331 C MLY G 20 2883 2939 3063 315 -130 -261 C
HETATM 5332 O MLY G 20 -5.065 11.078 -30.659 1.00 21.97 O
ANISOU 5332 O MLY G 20 2576 2875 2897 459 -350 -559 O