Sequence     &     Structural     Information
	
PTM
PTM Methylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 21
Annotation dbPTM details N6,N6,N6-trimethyllysine; alternate.
N6,N6-dimethyllysine; alternate.
N6-methyllysine; alternate.
N6,N6,N6-trimethyllysine
N6,N6-dimethyllysine
N6-acetyllysine
N6-methyllysine
N6-methylated lysine
Structure Information
PDB ID Code 3F9X
Model -
Chain H
Position 20
SCOP Class None
MODRES N-DIMETHYL-LYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
               ***** ****                                                                              
---------------AKRHRXVLRD------------------------------------------------------------------------------
               M____H___M                                                                              
                CCCCEECC                                                                               
                ZZddddZZ                                                                               

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XKRHRXVLRX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3F9X MLY H 20 LYS N-DIMETHYL-LYSINE
SHEET 4 O 4 MLY H 20 VAL H 21 1 O MLY H 20 N TYR D 274
LINK C ARG H 19 N MLY H 20 1555 1555 1.33
LINK C MLY H 20 N VAL H 21 1555 1555 1.33
SITE 5 AC4 19 ARG E 23 HIS H 18 MLY H 20
HETATM 5410 N MLY H 20 -2.704 26.811 -55.298 1.00 14.56 N
ANISOU 5410 N MLY H 20 1620 1737 2177 33 -265 80 N
HETATM 5411 CA MLY H 20 -1.901 25.600 -55.518 1.00 15.18 C
ANISOU 5411 CA MLY H 20 1717 1944 2106 -91 -168 88 C
HETATM 5412 CB MLY H 20 -1.095 25.799 -56.813 1.00 15.43 C
ANISOU 5412 CB MLY H 20 1735 2107 2020 43 -164 -38 C
HETATM 5413 CG MLY H 20 -2.005 25.970 -58.042 1.00 18.94 C
ANISOU 5413 CG MLY H 20 2107 2860 2231 -291 -229 -126 C
HETATM 5414 CD MLY H 20 -1.306 26.285 -59.385 1.00 19.15 C
ANISOU 5414 CD MLY H 20 2425 2533 2317 -398 -255 0 C
HETATM 5415 CE MLY H 20 -2.290 26.794 -60.482 1.00 19.65 C
ANISOU 5415 CE MLY H 20 2859 2349 2259 -139 -84 58 C
HETATM 5416 NZ MLY H 20 -1.757 26.953 -61.896 1.00 20.19 N
ANISOU 5416 NZ MLY H 20 2703 2472 2497 -128 506 -23 N
HETATM 5417 CH1 MLY H 20 -0.992 28.143 -62.446 1.00 15.41 C
ANISOU 5417 CH1 MLY H 20 1705 1902 2249 -289 -673 213 C
HETATM 5418 CH2 MLY H 20 -1.020 25.698 -62.178 1.00 22.29 C
ANISOU 5418 CH2 MLY H 20 3136 2983 2350 188 771 -270 C
HETATM 5419 C MLY H 20 -1.048 25.434 -54.298 1.00 15.60 C
ANISOU 5419 C MLY H 20 1576 2012 2340 -80 -184 122 C
HETATM 5420 O MLY H 20 -0.544 26.435 -53.731 1.00 16.24 O
ANISOU 5420 O MLY H 20 1314 2041 2815 -53 -382 54 O