Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 17
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 3QZS
Model -
Chain C
Position 16
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
            **** *****                                                                                 
------------KGGAXRHRKV---------------------------------------------------------------------------------
            MM__H_____                                                                                 
              CCCCCCCC                                                                                 
              ZZdddfZZ                                                                                 

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XXGAXRHRKV
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3QZS ALY C 16 LYS N(6)-ACETYLLYSINE
LINK C ALA C 15 N ALY C 16 1555 1555 1.33
LINK C ALY C 16 N ARG C 17 1555 1555 1.33
HETATM 1862 OH ALY C 16 10.869 7.643 7.313 1.00 11.39 O
ANISOU 1862 OH ALY C 16 2535 1002 790 -60 -240 -63 O
HETATM 1863 CH ALY C 16 12.042 7.868 7.519 1.00 15.07 C
ANISOU 1863 CH ALY C 16 2997 1374 1355 -89 -471 -60 C
HETATM 1864 CH3 ALY C 16 12.578 7.723 8.901 1.00 12.20 C
ANISOU 1864 CH3 ALY C 16 2829 1055 750 -51 -677 -125 C
HETATM 1865 NZ ALY C 16 12.864 8.266 6.555 1.00 16.15 N
ANISOU 1865 NZ ALY C 16 2925 1413 1797 -139 -553 43 N
HETATM 1866 CE ALY C 16 12.243 8.340 5.244 1.00 17.27 C
ANISOU 1866 CE ALY C 16 2879 1662 2020 -136 -345 133 C
HETATM 1867 CD ALY C 16 12.182 9.705 4.632 1.00 23.53 C
ANISOU 1867 CD ALY C 16 3487 2377 3077 -154 -401 228 C
HETATM 1868 CG ALY C 16 11.523 9.654 3.230 1.00 18.80 C
ANISOU 1868 CG ALY C 16 2681 2013 2448 -136 -192 389 C
HETATM 1869 CB ALY C 16 12.520 9.290 2.171 1.00 20.17 C
ANISOU 1869 CB ALY C 16 2597 2438 2628 -103 -149 617 C
HETATM 1870 CA ALY C 16 11.965 9.158 0.734 1.00 19.64 C
ANISOU 1870 CA ALY C 16 2319 2772 2369 -17 31 736 C
HETATM 1871 N ALY C 16 13.190 9.021 -0.094 1.00 25.44 N
ANISOU 1871 N ALY C 16 2762 3826 3077 67 82 981 N
HETATM 1872 C ALY C 16 10.988 10.187 0.169 1.00 19.23 C
ANISOU 1872 C ALY C 16 2139 2764 2404 -52 56 928 C
HETATM 1873 O ALY C 16 11.382 11.323 -0.213 1.00 20.95 O
ANISOU 1873 O ALY C 16 2076 2968 2916 -107 -17 1324 O