Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 17
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 3QZS
Model -
Chain D
Position 16
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
            **** *****                                                                                 
------------KGGAXRHRKV---------------------------------------------------------------------------------
            MM__H_____                                                                                 
              CCCCCCCC                                                                                 
              ZZcddfZZ                                                                                 

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XXGAXRHRKV
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3QZS ALY D 16 LYS N(6)-ACETYLLYSINE
LINK C ALA D 15 N ALY D 16 1555 1555 1.33
LINK C ALY D 16 N ARG D 17 1555 1555 1.32
HETATM 1933 OH ALY D 16 -12.059 -2.498 34.748 1.00 15.62 O
ANISOU 1933 OH ALY D 16 2392 2186 1356 -27 354 337 O
HETATM 1934 CH ALY D 16 -10.870 -2.688 34.564 1.00 17.75 C
ANISOU 1934 CH ALY D 16 2543 2583 1619 13 516 453 C
HETATM 1935 CH3 ALY D 16 -10.198 -2.454 33.240 1.00 15.33 C
ANISOU 1935 CH3 ALY D 16 2419 2170 1234 154 738 539 C
HETATM 1936 NZ ALY D 16 -10.063 -3.042 35.538 1.00 18.91 N
ANISOU 1936 NZ ALY D 16 2376 2983 1826 -52 523 537 N
HETATM 1937 CE ALY D 16 -10.621 -3.216 36.863 1.00 21.26 C
ANISOU 1937 CE ALY D 16 2551 3365 2161 -169 346 465 C
HETATM 1938 CD ALY D 16 -10.689 -4.576 37.465 1.00 20.98 C
ANISOU 1938 CD ALY D 16 2459 3398 2116 -6 298 516 C
HETATM 1939 CG ALY D 16 -11.274 -4.445 38.900 1.00 20.97 C
ANISOU 1939 CG ALY D 16 2370 3457 2141 -152 154 442 C
HETATM 1940 CB ALY D 16 -10.202 -4.447 39.986 1.00 20.84 C
ANISOU 1940 CB ALY D 16 2077 3747 2096 -235 111 535 C
HETATM 1941 CA ALY D 16 -10.753 -4.096 41.371 1.00 20.36 C
ANISOU 1941 CA ALY D 16 2045 3696 1996 -389 -19 447 C
HETATM 1942 N ALY D 16 -9.600 -3.962 42.283 1.00 24.99 N
ANISOU 1942 N ALY D 16 2387 4597 2512 -510 -127 533 N
HETATM 1943 C ALY D 16 -11.813 -5.065 41.901 1.00 17.65 C
ANISOU 1943 C ALY D 16 1842 3200 1664 -228 -18 418 C
HETATM 1944 O ALY D 16 -11.523 -6.228 42.213 1.00 18.40 O
ANISOU 1944 O ALY D 16 1893 3371 1726 -38 8 511 O