Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 17
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 3QZT
Model -
Chain B
Position 16
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
            **** *****                                                                                 
------------KGGAXRHRKV---------------------------------------------------------------------------------
            MM__H___MM                                                                                 
              CCCCCC                                                                                   
              ZZddZZ                                                                                   

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XXGAXRHRXX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3QZT ALY B 16 LYS N(6)-ACETYLLYSINE
LINK C ALA B 15 N ALY B 16 1555 1555 1.32
LINK C ALY B 16 N ARG B 17 1555 1555 1.32
HETATM 956 OH ALY B 16 24.246 2.921 10.348 1.00 13.84 O
ANISOU 956 OH ALY B 16 1649 1961 1646 -174 9 7 O
HETATM 957 CH ALY B 16 24.296 2.979 11.542 1.00 13.58 C
ANISOU 957 CH ALY B 16 1606 1868 1683 -141 29 -18 C
HETATM 958 CH3 ALY B 16 23.119 2.510 12.345 1.00 16.35 C
ANISOU 958 CH3 ALY B 16 1959 2185 2068 -169 28 -58 C
HETATM 959 NZ ALY B 16 25.354 3.433 12.196 1.00 19.15 N
ANISOU 959 NZ ALY B 16 2305 2539 2430 -97 51 -9 N
HETATM 960 CE ALY B 16 26.466 3.948 11.373 1.00 23.57 C
ANISOU 960 CE ALY B 16 2845 3133 2979 -72 61 40 C
HETATM 961 CD ALY B 16 27.838 4.213 11.916 1.00 27.85 C
ANISOU 961 CD ALY B 16 3372 3639 3572 -30 79 62 C
HETATM 962 CG ALY B 16 28.659 4.501 10.671 1.00 28.81 C
ANISOU 962 CG ALY B 16 3471 3810 3664 -20 112 107 C
HETATM 963 CB ALY B 16 29.993 3.821 10.766 1.00 33.58 C
ANISOU 963 CB ALY B 16 4075 4379 4305 22 173 100 C
HETATM 964 CA ALY B 16 31.041 4.839 10.394 1.00 33.72 C
ANISOU 964 CA ALY B 16 4023 4413 4378 41 183 179 C
HETATM 965 N ALY B 16 31.348 4.550 9.003 1.00 36.97 N
ANISOU 965 N ALY B 16 4456 4878 4712 28 272 172 N
HETATM 966 C ALY B 16 32.160 4.596 11.327 1.00 33.12 C
ANISOU 966 C ALY B 16 3904 4268 4410 78 175 207 C
HETATM 967 O ALY B 16 32.990 3.702 11.118 1.00 34.46 O
ANISOU 967 O ALY B 16 4059 4404 4629 113 245 201 O