Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 13
Annotation dbPTM details N6-acetyllysine.
Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
N6-acetyllysine
Structure Information
PDB ID Code 3QZV
Model -
Chain C
Position 12
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
       ***** *****                                                                                     
-------GKGLGXGGAKR-------------------------------------------------------------------------------------
       _____HMMMMM                                                                                     
       CCSSCC                                                                                          
       ZZfbZZ                                                                                          

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
GKGLGXXXXXX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 3QZV ALY C 12 LYS N(6)-ACETYLLYSINE
LINK C GLY C 11 N ALY C 12 1555 1555 1.33
HETATM 1408 OH ALY C 12 2.233 6.052 -12.183 1.00 31.43 O
ANISOU 1408 OH ALY C 12 3376 5570 2994 -804 206 -991 O
HETATM 1409 CH ALY C 12 2.439 7.255 -12.264 1.00 33.54 C
ANISOU 1409 CH ALY C 12 3669 5813 3260 -744 2 -435 C
HETATM 1410 CH3 ALY C 12 3.679 7.773 -12.965 1.00 34.66 C
ANISOU 1410 CH3 ALY C 12 3749 6172 3247 -1083 164 -375 C
HETATM 1411 NZ ALY C 12 1.651 8.188 -11.729 1.00 33.56 N
ANISOU 1411 NZ ALY C 12 3693 5526 3533 -402 -317 97 N
HETATM 1412 CE ALY C 12 0.450 7.836 -10.976 1.00 32.90 C
ANISOU 1412 CE ALY C 12 3568 5321 3612 -97 -400 24 C
HETATM 1413 CD ALY C 12 -0.717 8.662 -11.471 1.00 39.82 C
ANISOU 1413 CD ALY C 12 4181 6459 4491 -41 -750 649 C
HETATM 1414 CG ALY C 12 -1.973 8.189 -10.761 1.00 41.37 C
ANISOU 1414 CG ALY C 12 4199 6681 4838 200 -741 448 C
HETATM 1415 CB ALY C 12 -3.143 9.065 -11.149 1.00 48.66 C
ANISOU 1415 CB ALY C 12 4691 7789 6010 394 -1125 1053 C
HETATM 1416 CA ALY C 12 -4.288 8.914 -10.154 1.00 49.12 C
ANISOU 1416 CA ALY C 12 4466 7748 6448 758 -1013 756 C
HETATM 1417 N ALY C 12 -4.812 7.557 -10.225 1.00 47.97 N
ANISOU 1417 N ALY C 12 4284 8116 5827 358 -832 382 N
HETATM 1418 C ALY C 12 -5.377 9.895 -10.562 1.00 56.55 C
ANISOU 1418 C ALY C 12 4814 8758 7914 1078 -1429 1359 C
HETATM 1419 O ALY C 12 -6.421 9.498 -11.080 1.00 61.09 O
ANISOU 1419 O ALY C 12 4941 9980 8289 915 -1646 1546 O
TER 1420 ALY C 12