Sequence     &     Structural     Information 
	

		
			

				PTM
			

		
		
			

				PTM
				Acetylation
			

		

		
			

				Sequence Information
			


		
		
			

				Uniprot AC
				P62805
			

			

				Organism
				HUMAN (Human)
			

			

				Modified Amino Acid
				K(Lys) 6
			

			

				Annotation dbPTM details
				N6-acetyllysine.
N6-acetyllysine		
			

		

		
			

				Structure Information
			


		
		
			

				PDB ID Code
				3UVW
			

			

				Model
				-
			

			

				Chain
				B
			

			

				Position
				5
			

			

				SCOP Class
				None
			

			

				MODRES
				N(6)-ACETYLLYSINE                        
			

		

		
			

				Related PTM
			


		
		
			

				Found in same PDB Chain
				8
			

			

				Found in same Uniprot AC
Sort by:
PDB ID Code
  (idpdb-chain_aa)
Sequence position
  (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame 



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?) 

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
 **** ** ***                                       *                                                   
-SGRGXGGXGLG---------------------------------------Y---------------------------------------------------
 ____H__H___                                       S                                                   
 CCSCCCCCSCC                                       C                                                   
 ZZbnojehlaZ                                       Z

Scripts     (PyMol,     Modeller,     ...)

PyMol 
	Download
Modeller 
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
SGRGXGGXGLGY 
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			

			

			
				

REMARK 500    ALY B   5   C     GLY B   6   N       0.234                       
MODRES 3UVW ALY B    5  LYS  N(6)-ACETYLLYSINE                                  
LINK         C   GLY B   4                 N   ALY B   5     1555   1555  1.43  
LINK         C   ALY B   5                 N   GLY B   6     1555   1555  1.57  
HETATM 1136  OH  ALY B   5      29.414  35.347  20.167  1.00  8.38           O  
ANISOU 1136  OH  ALY B   5     1161    982   1039    -50     91   -202       O  
HETATM 1137  CH  ALY B   5      29.266  34.157  19.892  1.00  7.91           C  
ANISOU 1137  CH  ALY B   5     1036    817   1151      9    127    139       C  
HETATM 1138  CH3 ALY B   5      30.221  33.394  18.994  1.00  8.69           C  
ANISOU 1138  CH3 ALY B   5     1199    960   1139    188    282   -262       C  
HETATM 1139  NZ  ALY B   5      28.256  33.452  20.425  1.00  8.57           N  
ANISOU 1139  NZ  ALY B   5      994   1595    665     -8     59     74       N  
HETATM 1140  CE  ALY B   5      27.197  33.995  21.295  1.00  9.68           C  
ANISOU 1140  CE  ALY B   5     1254   1257   1164    -57    376     71       C  
HETATM 1141  CD  ALY B   5      27.374  33.418  22.686  1.00  9.95           C  
ANISOU 1141  CD  ALY B   5     1640   1326    815    -67    663     69       C  
HETATM 1142  CG  ALY B   5      26.290  33.922  23.609  1.00 10.41           C  
ANISOU 1142  CG  ALY B   5     1271   1493   1189    147    -11     79       C  
HETATM 1143  CB  ALY B   5      26.489  33.317  24.999  1.00  9.82           C  
ANISOU 1143  CB  ALY B   5     1433   1254   1041    305     15    -99       C  
HETATM 1144  CA  ALY B   5      25.461  33.884  25.939  1.00 11.43           C  
ANISOU 1144  CA  ALY B   5     1832   1511    999    -98   -101    286       C  
HETATM 1145  N   ALY B   5      25.743  35.302  26.222  1.00 12.09           N  
ANISOU 1145  N   ALY B   5     1769   1619   1203    419    198   -109       N  
HETATM 1146  C   ALY B   5      25.363  33.111  27.209  1.00 11.53           C  
ANISOU 1146  C   ALY B   5     1574   1347   1459    125    237    -44       C  
HETATM 1147  O   ALY B   5      25.089  31.900  27.278  1.00 13.16           O  
ANISOU 1147  O   ALY B   5     1986   1493   1518    126    265    338       O