Sequence     &     Structural     Information 
	

		
			

				PTM
			

		
		
			

				PTM
				Acetylation
			

		

		
			

				Sequence Information
			


		
		
			

				Uniprot AC
				P62805
			

			

				Organism
				HUMAN (Human)
			

			

				Modified Amino Acid
				K(Lys) 9
			

			

				Annotation dbPTM details
				N6-acetyllysine.
N6-acetyllysine		
			

		

		
			

				Structure Information
			


		
		
			

				PDB ID Code
				3UVW
			

			

				Model
				-
			

			

				Chain
				B
			

			

				Position
				8
			

			

				SCOP Class
				None
			

			

				MODRES
				N(6)-ACETYLLYSINE                        
			

		

		
			

				Related PTM
			


		
		
			

				Found in same PDB Chain
				5
			

			

				Found in same Uniprot AC
Sort by:
PDB ID Code
  (idpdb-chain_aa)
Sequence position
  (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame 



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?) 

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
 **** ** ***                                       *                                                   
-SGRGXGGXGLG---------------------------------------Y---------------------------------------------------
 ____H__H___                                       S                                                   
 CCSCCCCCSCC                                       C                                                   
 ZZbnojehlaZ                                       Z

Scripts     (PyMol,     Modeller,     ...)

PyMol 
	Download
Modeller 
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
SGRGXGGXGLGY 
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			

			

			
				

REMARK 500    ALY B   8   C     GLY B   9   N       0.228                       
MODRES 3UVW ALY B    8  LYS  N(6)-ACETYLLYSINE                                  
LINK         C   GLY B   7                 N   ALY B   8     1555   1555  1.45  
LINK         C   ALY B   8                 N   GLY B   9     1555   1555  1.56  
HETATM 1156  OH  ALY B   8      28.593  30.106  22.782  1.00 11.37           O  
ANISOU 1156  OH  ALY B   8     1482   1541   1297     -6    -91    286       O  
HETATM 1157  CH  ALY B   8      27.802  29.734  23.693  1.00 10.39           C  
ANISOU 1157  CH  ALY B   8     1274   1213   1458    -40    295     -8       C  
HETATM 1158  CH3 ALY B   8      26.474  29.114  23.417  1.00 12.95           C  
ANISOU 1158  CH3 ALY B   8     1319   1325   2276      6   -230    -48       C  
HETATM 1159  NZ  ALY B   8      28.103  29.946  24.995  1.00 11.06           N  
ANISOU 1159  NZ  ALY B   8     1400   1255   1545     24    169    221       N  
HETATM 1160  CE  ALY B   8      29.369  30.583  25.412  1.00 11.63           C  
ANISOU 1160  CE  ALY B   8     1543   1689   1188    -42      7    -72       C  
HETATM 1161  CD  ALY B   8      30.327  29.604  26.106  1.00 14.09           C  
ANISOU 1161  CD  ALY B   8     1861   1896   1594   -362   -268    313       C  
HETATM 1162  CG  ALY B   8      29.803  29.190  27.455  1.00 13.81           C  
ANISOU 1162  CG  ALY B   8     1583   1777   1888     14     65    144       C  
HETATM 1163  CB  ALY B   8      30.859  28.500  28.307  1.00 11.06           C  
ANISOU 1163  CB  ALY B   8     1295   1707   1197     63    613    -18       C  
HETATM 1164  CA  ALY B   8      30.122  27.997  29.526  1.00 12.48           C  
ANISOU 1164  CA  ALY B   8     1930   1485   1325    -22   -188   -356       C  
HETATM 1165  N   ALY B   8      29.784  29.093  30.429  1.00 12.60           N  
ANISOU 1165  N   ALY B   8     1946   1753   1087    -34    442    319       N  
HETATM 1166  C   ALY B   8      30.977  27.091  30.317  1.00 11.09           C  
ANISOU 1166  C   ALY B   8     1593   1548   1072    -11    296   -277       C  
HETATM 1167  O   ALY B   8      31.827  26.368  29.901  1.00 11.02           O  
ANISOU 1167  O   ALY B   8     1988   1019   1179     68    241    166       O