Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 13
Annotation dbPTM details N6-acetyllysine.
Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
N6-acetyllysine
Structure Information
PDB ID Code 4QUT
Model -
Chain B
Position 12
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
         *** ***                                   *                                                   
---------GLGXGGA-----------------------------------Y---------------------------------------------------
         ___H_MM                                   M                                                   
         CCCCC                                                                                         
         ZZjZZ                                                                                         

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
GLGXGXXX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 4QUT ALY B 12 LYS N(6)-ACETYLLYSINE
LINK C GLY B 11 N ALY B 12 1555 1555 1.33
LINK C ALY B 12 N GLY B 13 1555 1555 1.33
HETATM 1196 OH ALY B 12 24.385 43.471 -11.689 1.00 18.34 O
ANISOU 1196 OH ALY B 12 2144 2694 2130 11 171 82 O
HETATM 1197 CH ALY B 12 24.640 44.326 -10.819 1.00 20.20 C
ANISOU 1197 CH ALY B 12 2362 2909 2403 -32 198 66 C
HETATM 1198 CH3 ALY B 12 23.837 44.415 -9.539 1.00 20.35 C
ANISOU 1198 CH3 ALY B 12 2375 2909 2447 -39 159 56 C
HETATM 1199 NZ ALY B 12 25.600 45.245 -10.982 1.00 22.89 N
ANISOU 1199 NZ ALY B 12 2692 3242 2765 -82 270 53 N
HETATM 1200 CE ALY B 12 26.352 45.252 -12.239 1.00 25.84 C
ANISOU 1200 CE ALY B 12 3077 3627 3115 -76 319 68 C
HETATM 1201 CD ALY B 12 27.235 46.488 -12.479 1.00 30.37 C
ANISOU 1201 CD ALY B 12 3652 4167 3719 -141 425 57 C
HETATM 1202 CG ALY B 12 28.565 46.397 -11.809 1.00 32.83 C
ANISOU 1202 CG ALY B 12 3875 4541 4057 -205 440 -18 C
HETATM 1203 CB ALY B 12 29.367 47.708 -11.892 1.00 33.44 C
ANISOU 1203 CB ALY B 12 3948 4581 4178 -298 558 -50 C
HETATM 1204 CA ALY B 12 29.921 48.024 -13.274 1.00 33.54 C
ANISOU 1204 CA ALY B 12 3999 4566 4177 -295 647 -14 C
HETATM 1205 N ALY B 12 30.535 46.855 -13.874 1.00 30.62 N
ANISOU 1205 N ALY B 12 3588 4278 3768 -246 599 -16 N
HETATM 1206 C ALY B 12 30.924 49.170 -13.193 1.00 41.36 C
ANISOU 1206 C ALY B 12 4967 5527 5221 -407 774 -69 C
HETATM 1207 O ALY B 12 30.716 50.134 -12.449 1.00 43.38 O
ANISOU 1207 O ALY B 12 5237 5724 5522 -476 827 -101 O