Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 6
Annotation dbPTM details N6-acetyllysine.
N6-acetyllysine
Structure Information
PDB ID Code 4QUU
Model -
Chain B
Position 5
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
   ** ** *** ***                                                                                       
---RGXGGXGLGXGGAY--------------------------------------------------------------------------------------
   __H__MMMMMMMMM                                                                                      
   CCCCC                                                                                               
   ZZeZZ                                                                                               

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
RGXGGXXXXXXXXX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 4QUU ALY B 5 LYS N(6)-ACETYLLYSINE
LINK C GLY B 4 N ALY B 5 1555 1555 1.33
LINK C ALY B 5 N GLY B 6 1555 1555 1.34
HETATM 1182 OH ALY B 5 24.068 43.444 -11.689 1.00 27.26 O
ANISOU 1182 OH ALY B 5 2960 4491 2905 81 345 447 O
HETATM 1183 CH ALY B 5 24.194 44.348 -10.891 1.00 27.96 C
ANISOU 1183 CH ALY B 5 3025 4514 3083 -18 378 437 C
HETATM 1184 CH3 ALY B 5 23.382 44.419 -9.617 1.00 27.66 C
ANISOU 1184 CH3 ALY B 5 3010 4398 3101 -61 311 375 C
HETATM 1185 NZ ALY B 5 24.998 45.381 -11.030 1.00 30.93 N
ANISOU 1185 NZ ALY B 5 3357 4871 3523 -102 484 470 N
HETATM 1186 CE ALY B 5 25.850 45.594 -12.177 1.00 34.56 C
ANISOU 1186 CE ALY B 5 3789 5389 3952 -81 582 543 C
HETATM 1187 CD ALY B 5 27.187 45.002 -11.864 1.00 35.96 C
ANISOU 1187 CD ALY B 5 3850 5694 4120 -112 574 479 C
HETATM 1188 CG ALY B 5 28.020 45.098 -13.100 1.00 36.94 C
ANISOU 1188 CG ALY B 5 3946 5889 4202 -75 673 557 C
HETATM 1189 CB ALY B 5 29.430 44.696 -12.745 1.00 38.35 C
ANISOU 1189 CB ALY B 5 3984 6207 4380 -117 681 493 C
HETATM 1190 CA ALY B 5 30.261 44.414 -13.983 1.00 39.75 C
ANISOU 1190 CA ALY B 5 4130 6487 4485 -44 758 566 C
HETATM 1191 N ALY B 5 29.634 43.365 -14.791 1.00 37.16 N
ANISOU 1191 N ALY B 5 3896 6192 4032 122 689 598 N
HETATM 1192 C ALY B 5 31.637 43.998 -13.530 1.00 44.42 C
ANISOU 1192 C ALY B 5 4567 7239 5072 -78 759 495 C
HETATM 1193 O ALY B 5 32.488 44.856 -13.284 1.00 47.67 O
ANISOU 1193 O ALY B 5 4867 7674 5572 -216 851 470 O