Sequence     &     Structural     Information
	
PTM
PTM Acetylation
Sequence Information
Uniprot AC P62805
Organism HUMAN (Human)
Modified Amino Acid K(Lys) 13
Annotation dbPTM details N6-acetyllysine.
Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
N6-acetyllysine
Structure Information
PDB ID Code 4QYD
Model -
Chain B
Position 12
SCOP Class None
MODRES N(6)-ACETYLLYSINE
Related PTM
Found in same PDB Chain -
Found in same Uniprot AC
Sort by: PDB ID Code (idpdb-chain_aa) Sequence position (aa_idpdb-chain)
Gallery (?)
Slide 1
Slide 2
Example Frame



Note: As the images production is automatic, the focus on the PTM site could not be the most optimized.
      In these cases it is recommended to use the PyMOL script to visualize the PTM site in 3D.
Alignment
(?)

	           Numerotation

	(?)       Uniprot Sequence
	(?)                Clustal
	(?)           PDB Sequence
	(?)        PDB Information
	(?)          DSSP Sequence
	(?) Protein Block Sequence
	
         1         2         3         4         5         6         7         8         9         10        
123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012


MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
    ******** *****                                                                                     
----GKGGKGLGXGGAKR-------------------------------------------------------------------------------------
    MM______H_MMMM                                                                                     
      CCCCSCCC                                                                                         
      ZZdfbjZZ                                                                                         

Scripts     (PyMol,     Modeller,     ...)

PyMol
	Download
Modeller
	
If you want to use this structure as a template for modelisation with Modeller, you can use the following sequence to build the alignment file "*.ali".

To avoid the classical Modeller error :

			'Number of residues in the alignment and pdb files are different'(see FAQ n°17),

the missing residues, non-classical amino-acids, and sequence gaps have been replaced by a "X" symbol.
			
XXGGKGLGXGXXXX
1) align this sequence with your sequence to modelised;
2) replace the "X" by "-" in the obtained alignement, then build your "*.ali" file;
3) use Modeller to make your models;
4) And finally use the following information found in the PDB to add this PTM in your models (see FAQ n°8 & 9 and this archive of Modeller usage).
			
MODRES 4QYD ALY B 12 LYS N(6)-ACETYLLYSINE
LINK C GLY B 11 N ALY B 12 1555 1555 1.33
LINK C ALY B 12 N GLY B 13 1555 1555 1.33
HETATM 981 OH ALY B 12 5.081 95.171 97.864 1.00 23.66 O
ANISOU 981 OH ALY B 12 2595 3080 3313 454 845 172 O
HETATM 982 CH ALY B 12 5.646 95.269 98.949 1.00 28.17 C
ANISOU 982 CH ALY B 12 3054 3549 4102 375 682 214 C
HETATM 983 CH3 ALY B 12 6.956 94.583 99.210 1.00 25.05 C
ANISOU 983 CH3 ALY B 12 2569 2999 3951 386 803 513 C
HETATM 984 NZ ALY B 12 5.168 95.978 99.978 1.00 23.37 N
ANISOU 984 NZ ALY B 12 2404 2965 3509 297 391 19 N
HETATM 985 CE ALY B 12 3.924 96.748 99.928 1.00 21.60 C
ANISOU 985 CE ALY B 12 2227 2875 3105 324 285 -217 C
HETATM 986 CD ALY B 12 2.695 95.834 100.001 1.00 22.84 C
ANISOU 986 CD ALY B 12 2513 3279 2888 271 375 -431 C
HETATM 987 CG ALY B 12 1.388 96.610 99.799 1.00 25.65 C
ANISOU 987 CG ALY B 12 2856 3803 3087 322 307 -568 C
HETATM 988 CB ALY B 12 1.147 97.663 100.883 1.00 25.30 C
ANISOU 988 CB ALY B 12 2785 3708 3120 398 110 -697 C
HETATM 989 CA ALY B 12 -0.335 98.068 100.980 1.00 24.37 C
ANISOU 989 CA ALY B 12 2658 3810 2793 484 122 -811 C
HETATM 990 N ALY B 12 -0.769 98.703 99.745 1.00 24.83 N
ANISOU 990 N ALY B 12 2630 3915 2888 537 184 -689 N
HETATM 991 C ALY B 12 -0.502 98.981 102.166 1.00 34.07 C
ANISOU 991 C ALY B 12 3948 4957 4039 623 -21 -978 C
HETATM 992 O ALY B 12 -0.317 98.535 103.316 1.00 45.42 O
ANISOU 992 O ALY B 12 5476 6427 5354 624 -88 -1090 O